Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESRRG Rabbit Polyclonal Antibody (Biotin)

ESRRG Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ERR3, ERRg, NR3B3, ERRgamma, ERR-gamma

UniProt

P62508

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ESRRG

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001429

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL7B (B Cell CLL/Lymphoma 7 Protein Family Member B, Allergen=Hom s 3) (MaxLight 490)
123897-ML490 100 µL

BCL7B (B Cell CLL/Lymphoma 7 Protein Family Member B, Allergen=Hom s 3) (MaxLight 490)

Sign In for Pricing
View Details
Rabbit Polyclonal RABGAP1 Antibody [CoraFluor 1]
NBP2-44285CL1 0.1 mL

Rabbit Polyclonal RABGAP1 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
PGAP3 Rabbit Polyclonal Antibody
TA342058 100 µL

PGAP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARX (aristaless Related Homeobox, ISSX, MRX29, MRX32, MRX33, MRX36, MRX38, MRX43, MRX54, MRX76, MRX87, MRXS1, PRTS) (AP)
MBS6163132-01 0.1 mL

ARX (aristaless Related Homeobox, ISSX, MRX29, MRX32, MRX33, MRX36, MRX38, MRX43, MRX54, MRX76, MRX87, MRXS1, PRTS) (AP)

Sign In for Pricing
View Details
ARX (aristaless Related Homeobox, ISSX, MRX29, MRX32, MRX33, MRX36, MRX38, MRX43, MRX54, MRX76, MRX87, MRXS1, PRTS) (AP)
MBS6163132-02 5x 0.1 mL

ARX (aristaless Related Homeobox, ISSX, MRX29, MRX32, MRX33, MRX36, MRX38, MRX43, MRX54, MRX76, MRX87, MRXS1, PRTS) (AP)

Sign In for Pricing
View Details
RPS12P27-set siRNA/shRNA/RNAi Lentivector (Human)
42071091 4x 500 ng

RPS12P27-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details