Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESRRG Rabbit Polyclonal Antibody (HRP)

ESRRG Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ERR3, ERRg, NR3B3, ERRgamma, ERR-gamma

UniProt

P62508

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ESRRG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001429

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS4 Polyclonal Antibody
E-AB-66810-01 60 µL

RGS4 Polyclonal Antibody

Sign In for Pricing
View Details
RGS4 Polyclonal Antibody
E-AB-66810-02 120 µL

RGS4 Polyclonal Antibody

Sign In for Pricing
View Details
RGS4 Polyclonal Antibody
E-AB-66810-03 200 µL

RGS4 Polyclonal Antibody

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/1623), Biotin conjugate, 0.1mg/mL
BNCB3804-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/1623), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adiponectin (ADIPOQ) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8A9]
TA804680AM 100 µL

Adiponectin (ADIPOQ) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8A9]

Sign In for Pricing
View Details
RNF24 Rabbit Polyclonal Antibody
TA370468 100 µL

RNF24 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details