Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RXRA Rabbit Polyclonal Antibody (HRP)

RXRA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NR2B1

UniProt

P19793

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RXRA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002948

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Org 25543 Hydrochloride
TRC-O674985-1G 1 g

Org 25543 Hydrochloride

Sign In for Pricing
View Details
2-Bromo Ethane Sulphonic Acid Sodium Salt for Synthesis
1021360 10-01 10 g

2-Bromo Ethane Sulphonic Acid Sodium Salt for Synthesis

Sign In for Pricing
View Details
2-Bromo Ethane Sulphonic Acid Sodium Salt for Synthesis
1021360 10-02 10 g

2-Bromo Ethane Sulphonic Acid Sodium Salt for Synthesis

Sign In for Pricing
View Details
HDHD5 Antibody / Haloacid dehalogenase-like hydrolase domain-containing 5 / CECR5
FY13164 100 µL

HDHD5 Antibody / Haloacid dehalogenase-like hydrolase domain-containing 5 / CECR5

Sign In for Pricing
View Details
Histone cluster 2 H2BE CRISPR/Cas9 KO Plasmid (h)
sc-411151 20 µg

Histone cluster 2 H2BE CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
IL11RA Biosimilar Antibody
orb3183116-01 100 µg

IL11RA Biosimilar Antibody

Sign In for Pricing
View Details