Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR2E1 Rabbit Polyclonal Antibody (Biotin)

NR2E1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TLL, TLX, XTLL

UniProt

Q9Y466

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NR2E1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003260

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AaeA Antibody
orb808824 2 mg

AaeA Antibody

Sign In for Pricing
View Details
CD11c (Monocyte/Macrophage, CD11 Antigen-like Family Member C, Complement Component 3 Receptor 4 Subunit, Integrin alphaX, ITGAX, ITAX, Leukocyte Adhesion Glycoprotein p150,95 alpha Chain, Leukocyte Adhesion Receptor p150,95, Leu M5, Leukocyte Surface Ant
MBS6255482-01 0.1 mL

CD11c (Monocyte/Macrophage, CD11 Antigen-like Family Member C, Complement Component 3 Receptor 4 Subunit, Integrin alphaX, ITGAX, ITAX, Leukocyte Adhesion Glycoprotein p150,95 alpha Chain, Leukocyte Adhesion Receptor p150,95, Leu M5, Leukocyte Surface Ant

Sign In for Pricing
View Details
CD11c (Monocyte/Macrophage, CD11 Antigen-like Family Member C, Complement Component 3 Receptor 4 Subunit, Integrin alphaX, ITGAX, ITAX, Leukocyte Adhesion Glycoprotein p150,95 alpha Chain, Leukocyte Adhesion Receptor p150,95, Leu M5, Leukocyte Surface Ant
MBS6255482-02 5x 0.1 mL

CD11c (Monocyte/Macrophage, CD11 Antigen-like Family Member C, Complement Component 3 Receptor 4 Subunit, Integrin alphaX, ITGAX, ITAX, Leukocyte Adhesion Glycoprotein p150,95 alpha Chain, Leukocyte Adhesion Receptor p150,95, Leu M5, Leukocyte Surface Ant

Sign In for Pricing
View Details
EIF6 (Phospho-Ser235) Rabbit Polyclonal Antibody
MBS9511969-01 0.05 mL

EIF6 (Phospho-Ser235) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EIF6 (Phospho-Ser235) Rabbit Polyclonal Antibody
MBS9511969-02 0.1 mL

EIF6 (Phospho-Ser235) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EIF6 (Phospho-Ser235) Rabbit Polyclonal Antibody
MBS9511969-03 5x 0.1 mL

EIF6 (Phospho-Ser235) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details