Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESRRA Rabbit Polyclonal Antibody (HRP)

ESRRA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ERR1, ERRa, ESRL1, NR3B1, ERRalpha

UniProt

P11474

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ESRRA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_004442

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), CF594 conjugate, 0.1mg/mL
BNC942807-500 1x 500 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DKK2 Polyclonal Antibody
E-AB-66361-01 60 µL

DKK2 Polyclonal Antibody

Sign In for Pricing
View Details
DKK2 Polyclonal Antibody
E-AB-66361-02 120 µL

DKK2 Polyclonal Antibody

Sign In for Pricing
View Details
DKK2 Polyclonal Antibody
E-AB-66361-03 200 µL

DKK2 Polyclonal Antibody

Sign In for Pricing
View Details
P21 / WAF1 (HJ21), CF488A conjugate, 0.1mg/mL
BNC880984-100 1x 100 µL

P21 / WAF1 (HJ21), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
THAP2 Polyclonal Antibody
E-AB-65443-01 60 µL

THAP2 Polyclonal Antibody

Sign In for Pricing
View Details