Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RXRG Rabbit Polyclonal Antibody (Biotin)

RXRG Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RXRC, NR2B3

UniProt

P48443

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RXRG

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_008848

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B3GALT4 Antibody
A73701-100UL 100 µL

B3GALT4 Antibody

Sign In for Pricing
View Details
Bcl-X (Apoptosis regulator Bcl-X, B cell lymphoma 2 like, BCL XL/S, Bcl-2-like protein 1, Bcl2-L-1, BCL2L, Bcl2l1, BCLX, BclXL, BclXs, Protein phosphatase 1 regulatory subunit 52 (PPP1R52)) (HRP)
MBS6122541-01 0.1 mL

Bcl-X (Apoptosis regulator Bcl-X, B cell lymphoma 2 like, BCL XL/S, Bcl-2-like protein 1, Bcl2-L-1, BCL2L, Bcl2l1, BCLX, BclXL, BclXs, Protein phosphatase 1 regulatory subunit 52 (PPP1R52)) (HRP)

Sign In for Pricing
View Details
Bcl-X (Apoptosis regulator Bcl-X, B cell lymphoma 2 like, BCL XL/S, Bcl-2-like protein 1, Bcl2-L-1, BCL2L, Bcl2l1, BCLX, BclXL, BclXs, Protein phosphatase 1 regulatory subunit 52 (PPP1R52)) (HRP)
MBS6122541-02 5x 0.1 mL

Bcl-X (Apoptosis regulator Bcl-X, B cell lymphoma 2 like, BCL XL/S, Bcl-2-like protein 1, Bcl2-L-1, BCL2L, Bcl2l1, BCLX, BclXL, BclXs, Protein phosphatase 1 regulatory subunit 52 (PPP1R52)) (HRP)

Sign In for Pricing
View Details
Mouse Monoclonal Transketolase Antibody (OTI5H3) [Dylight 594]
NBP2-74585DL594 0.1 mL

Mouse Monoclonal Transketolase Antibody (OTI5H3) [Dylight 594]

Sign In for Pricing
View Details
RUNX1T1 (Protein CBFA2T1, Cyclin-D-related Protein, Eight Twenty One Protein, Protein ETO, Protein MTG8, Zinc Finger MYND Domain-containing Protein 2, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2) (MaxLight 650)
MBS6224462-01 0.1 mL

RUNX1T1 (Protein CBFA2T1, Cyclin-D-related Protein, Eight Twenty One Protein, Protein ETO, Protein MTG8, Zinc Finger MYND Domain-containing Protein 2, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2) (MaxLight 650)

Sign In for Pricing
View Details
RUNX1T1 (Protein CBFA2T1, Cyclin-D-related Protein, Eight Twenty One Protein, Protein ETO, Protein MTG8, Zinc Finger MYND Domain-containing Protein 2, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2) (MaxLight 650)
MBS6224462-02 5x 0.1 mL

RUNX1T1 (Protein CBFA2T1, Cyclin-D-related Protein, Eight Twenty One Protein, Protein ETO, Protein MTG8, Zinc Finger MYND Domain-containing Protein 2, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2) (MaxLight 650)

Sign In for Pricing
View Details