Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RXRG Rabbit Polyclonal Antibody (FITC)

RXRG Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RXRC, NR2B3

UniProt

P48443

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RXRG

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_008848

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pin1 (Peptidyl-prolyl cis/trans Isomerase NIMA-interacting 1) (Biotin) discontinued
P4186-90-Biotin 100 µL

Pin1 (Peptidyl-prolyl cis/trans Isomerase NIMA-interacting 1) (Biotin) discontinued

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain RM11-1a)(Baker's yeast) SNN1 Polyclonal Antibody
MBS7170510 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain RM11-1a)(Baker's yeast) SNN1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti Human IRX1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8424053-01 0.12 mL

Rabbit Anti Human IRX1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti Human IRX1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8424053-02 5x 0.12 mL

Rabbit Anti Human IRX1 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(Western Blot, IHC, ELISA)

Sign In for Pricing
View Details
Mmu-miR-324-3p inhibitor
HY-RI03021-01 5 nmol

Mmu-miR-324-3p inhibitor

Sign In for Pricing
View Details
Mmu-miR-324-3p inhibitor
HY-RI03021-02 20 nmol

Mmu-miR-324-3p inhibitor

Sign In for Pricing
View Details