Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR1D1 Rabbit Polyclonal Antibody (FITC)

NR1D1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EAR1, hRev, THRA1, THRAL, ear-1, REVERBA, REVERBalpha

UniProt

P20393

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NR1D1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPA

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_068370

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

a1-Antitrypsin [A1A, A1AT, AAT, Alpha 1 antiproteinase, Alpha 1 protease inhibitor, alpha-1-AT, alpha1 PI, alpha1 proteinase inhibitor, Clade A (alpha 1 antiproteinase antitrypsin) member 1, MGC23330, MGC9222, PI, PI1, PRO2275, Protease inhibitor 1 (anti
MBS620269-01 0.02 mL

a1-Antitrypsin [A1A, A1AT, AAT, Alpha 1 antiproteinase, Alpha 1 protease inhibitor, alpha-1-AT, alpha1 PI, alpha1 proteinase inhibitor, Clade A (alpha 1 antiproteinase antitrypsin) member 1, MGC23330, MGC9222, PI, PI1, PRO2275, Protease inhibitor 1 (anti

Sign In for Pricing
View Details
a1-Antitrypsin [A1A, A1AT, AAT, Alpha 1 antiproteinase, Alpha 1 protease inhibitor, alpha-1-AT, alpha1 PI, alpha1 proteinase inhibitor, Clade A (alpha 1 antiproteinase antitrypsin) member 1, MGC23330, MGC9222, PI, PI1, PRO2275, Protease inhibitor 1 (anti
MBS620269-02 0.1 mL

a1-Antitrypsin [A1A, A1AT, AAT, Alpha 1 antiproteinase, Alpha 1 protease inhibitor, alpha-1-AT, alpha1 PI, alpha1 proteinase inhibitor, Clade A (alpha 1 antiproteinase antitrypsin) member 1, MGC23330, MGC9222, PI, PI1, PRO2275, Protease inhibitor 1 (anti

Sign In for Pricing
View Details
a1-Antitrypsin [A1A, A1AT, AAT, Alpha 1 antiproteinase, Alpha 1 protease inhibitor, alpha-1-AT, alpha1 PI, alpha1 proteinase inhibitor, Clade A (alpha 1 antiproteinase antitrypsin) member 1, MGC23330, MGC9222, PI, PI1, PRO2275, Protease inhibitor 1 (anti
MBS620269-03 5x 0.1 mL

a1-Antitrypsin [A1A, A1AT, AAT, Alpha 1 antiproteinase, Alpha 1 protease inhibitor, alpha-1-AT, alpha1 PI, alpha1 proteinase inhibitor, Clade A (alpha 1 antiproteinase antitrypsin) member 1, MGC23330, MGC9222, PI, PI1, PRO2275, Protease inhibitor 1 (anti

Sign In for Pricing
View Details
Phospho-mouse ERBB2 (S1114) Antibody [APR05326G]
APR05326G-01 50 µL

Phospho-mouse ERBB2 (S1114) Antibody [APR05326G]

Sign In for Pricing
View Details
Phospho-mouse ERBB2 (S1114) Antibody [APR05326G]
APR05326G-02 100 µL

Phospho-mouse ERBB2 (S1114) Antibody [APR05326G]

Sign In for Pricing
View Details
Phospho-mouse ERBB2 (S1114) Antibody [APR05326G]
APR05326G-03 200 µL

Phospho-mouse ERBB2 (S1114) Antibody [APR05326G]

Sign In for Pricing
View Details