Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSBPL11 Rabbit Polyclonal Antibody (Biotin)

OSBPL11 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ORP11, ORP-11, OSBP12, TCCCIA00292

UniProt

Q9BXB4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OSBPL11

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VDLTKLAVTKKRVRPLEKQDPFESRRLWKNVTDSLRESEIDKATEHKHTL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_073613

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Collagen TypeI (ColI) ELISA Kit
YP-W72347-01 48 Tests

Rabbit Collagen TypeI (ColI) ELISA Kit

Sign In for Pricing
View Details
Rabbit Collagen TypeI (ColI) ELISA Kit
YP-W72347-02 96 Tests

Rabbit Collagen TypeI (ColI) ELISA Kit

Sign In for Pricing
View Details
Tau isoform 4 Mouse mAb
E47M41252 100 µL

Tau isoform 4 Mouse mAb

Sign In for Pricing
View Details
[IHC]NeuN Rabbit Monoclonal Antibody, 1 pack = 50 µL
BAL3382 1 Each

[IHC]NeuN Rabbit Monoclonal Antibody, 1 pack = 50 µL

Sign In for Pricing
View Details
Human total ALT/GPT (Alanine aminotransferase) ELISA Kit
orb2938780-01 48 Tests

Human total ALT/GPT (Alanine aminotransferase) ELISA Kit

Sign In for Pricing
View Details
Human total ALT/GPT (Alanine aminotransferase) ELISA Kit
orb2938780-02 96 Tests

Human total ALT/GPT (Alanine aminotransferase) ELISA Kit

Sign In for Pricing
View Details