Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSBPL11 Rabbit Polyclonal Antibody (Biotin)

OSBPL11 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ORP11, ORP-11, OSBP12, TCCCIA00292

UniProt

Q9BXB4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OSBPL11

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VDLTKLAVTKKRVRPLEKQDPFESRRLWKNVTDSLRESEIDKATEHKHTL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_073613

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inactivated SARS-CoV-2 Vaccine (Chinese Academy of Medical Sciences)
THP-0328 1 Vial

Inactivated SARS-CoV-2 Vaccine (Chinese Academy of Medical Sciences)

Sign In for Pricing
View Details
Lentiviral human NKAIN4 sgRNA gene knockout kit - Lentiviral human NKAIN4 sgRNA gene knockout kit (25)
GTR15374838 1 Vial

Lentiviral human NKAIN4 sgRNA gene knockout kit - Lentiviral human NKAIN4 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
ATP1A2 Rabbit mAb
E45R11577N-50 50 µL

ATP1A2 Rabbit mAb

Sign In for Pricing
View Details
Rabbit Polyclonal BTG3 Antibody [Alexa Fluor 488]
NBP2-99254AF488 0.1 mL

Rabbit Polyclonal BTG3 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
SCIN (NM_033128) Human Over-expression Lysate
LC403229 20 µg

SCIN (NM_033128) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse CXC-Chemokine Ligand 15 ELISA Kit
MBS3806581-01 48 Well

Mouse CXC-Chemokine Ligand 15 ELISA Kit

Sign In for Pricing
View Details