Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OSBPL9 Rabbit Polyclonal Antibody (Biotin)

OSBPL9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ORP9, ORP-9

UniProt

Q8TAS8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human OSBPL9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_683702

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABHD5 (1-acylglycerol-3-phosphate O-acyltransferase ABHD5, Abhydrolase Domain-containing Protein 5, Lipid Droplet-binding Protein CGI-58, CGI-58, MGC8731, NCIE2) (Biotin)
MBS6140425-01 0.1 mL

ABHD5 (1-acylglycerol-3-phosphate O-acyltransferase ABHD5, Abhydrolase Domain-containing Protein 5, Lipid Droplet-binding Protein CGI-58, CGI-58, MGC8731, NCIE2) (Biotin)

Sign In for Pricing
View Details
ABHD5 (1-acylglycerol-3-phosphate O-acyltransferase ABHD5, Abhydrolase Domain-containing Protein 5, Lipid Droplet-binding Protein CGI-58, CGI-58, MGC8731, NCIE2) (Biotin)
MBS6140425-02 5x 0.1 mL

ABHD5 (1-acylglycerol-3-phosphate O-acyltransferase ABHD5, Abhydrolase Domain-containing Protein 5, Lipid Droplet-binding Protein CGI-58, CGI-58, MGC8731, NCIE2) (Biotin)

Sign In for Pricing
View Details
VN1R17P Human shRNA Plasmid Kit (Locus ID 441931)
TR318651 1 Kit

VN1R17P Human shRNA Plasmid Kit (Locus ID 441931)

Sign In for Pricing
View Details
MHC Class 1 Chain-related Gene A (MHC Class I Polypeptide-related Sequence A, MICA, MIC-A, FLJ60820, MGC111087, PERB11.1) (AP)
MBS6488075-01 0.2 mL

MHC Class 1 Chain-related Gene A (MHC Class I Polypeptide-related Sequence A, MICA, MIC-A, FLJ60820, MGC111087, PERB11.1) (AP)

Sign In for Pricing
View Details
MHC Class 1 Chain-related Gene A (MHC Class I Polypeptide-related Sequence A, MICA, MIC-A, FLJ60820, MGC111087, PERB11.1) (AP)
MBS6488075-02 5x 0.2 mL

MHC Class 1 Chain-related Gene A (MHC Class I Polypeptide-related Sequence A, MICA, MIC-A, FLJ60820, MGC111087, PERB11.1) (AP)

Sign In for Pricing
View Details
RPS21P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV784013 1.0 µg DNA

RPS21P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details