Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARG1 Rabbit Polyclonal Antibody (HRP)

ARG1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P05089

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ARG1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_000036

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCCA1 Rabbit Polyclonal Antibody
orb340912-01 30 µL

SCCA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SCCA1 Rabbit Polyclonal Antibody
orb340912-02 50 μL

SCCA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SCCA1 Rabbit Polyclonal Antibody
orb340912-03 100 µL

SCCA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SCCA1 Rabbit Polyclonal Antibody
orb340912-04 200 µL

SCCA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ERCC1 (Excision Repair Cross Complementing Rodent Repair Deficiency Complementation 1) ELISA Kit
MBS2511012-01 24 Tests

Human ERCC1 (Excision Repair Cross Complementing Rodent Repair Deficiency Complementation 1) ELISA Kit

Sign In for Pricing
View Details
Human ERCC1 (Excision Repair Cross Complementing Rodent Repair Deficiency Complementation 1) ELISA Kit
MBS2511012-02 48 Tests

Human ERCC1 (Excision Repair Cross Complementing Rodent Repair Deficiency Complementation 1) ELISA Kit

Sign In for Pricing
View Details