Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klkb1 Rabbit Polyclonal Antibody (HRP)

Klkb1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PK, Klk3, Kalp1, KALP15

UniProt

P14272

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSK

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036857

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 19 (BA17), CF405S conjugate, 0.1mg/mL
BNC040666-500 1x 500 µL

Cytokeratin 19 (BA17), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Incu-Shaker™ 10L with non-slip rubber mat, 230V
H2010-E 1 Each

Incu-Shaker™ 10L with non-slip rubber mat, 230V

Sign In for Pricing
View Details
Recombinant Human Complexin-2/CPLX2 Protein (His Tag)
PKSH030970 100 µg

Recombinant Human Complexin-2/CPLX2 Protein (His Tag)

Sign In for Pricing
View Details
Ethyl Malonyl Chloride
TRC-E922050-500MG 500 mg

Ethyl Malonyl Chloride

Sign In for Pricing
View Details
WAY 100635 Trihydrochloride
TRC-W498650-250MG 250 mg

WAY 100635 Trihydrochloride

Sign In for Pricing
View Details
Tissue FFPE Sections, Fallopian tube
CS801301 5x 5 µm

Tissue FFPE Sections, Fallopian tube

Sign In for Pricing
View Details