Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klkb1 Rabbit Polyclonal Antibody (HRP)

Klkb1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PK, Klk3, Kalp1, KALP15

UniProt

P14272

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSK

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036857

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HTRA3 activation kit by CRISPRa
GA114318 1 Kit

Human HTRA3 activation kit by CRISPRa

Sign In for Pricing
View Details
PPIA Rabbit Monoclonal Antibody [Clone ID: 24GB905]
TA425055 100 µL

PPIA Rabbit Monoclonal Antibody [Clone ID: 24GB905]

Sign In for Pricing
View Details
PSA (Prostate Specific Antigen) (A67-B/E3), CF647 conjugate, 0.1mg/mL
BNC470883-500 1x 500 µL

PSA (Prostate Specific Antigen) (A67-B/E3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Rabbit Affinity Purified Antibody to Human IgG,
AAF-331-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Affinity Purified Antibody to Human IgG,

Sign In for Pricing
View Details
Cell Meter™ Intracellular GSH Assay Kit *Optimized for Flow Cytometry with 405 nm excitation*
22809-AAT 100 Tests

Cell Meter™ Intracellular GSH Assay Kit *Optimized for Flow Cytometry with 405 nm excitation*

Sign In for Pricing
View Details
Caspase-1 Recombinant Rabbit monoclonal Antibody [SU40-07]
ET1608-69-50UL 50 µL

Caspase-1 Recombinant Rabbit monoclonal Antibody [SU40-07]

Sign In for Pricing
View Details