Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECHS1 Rabbit Polyclonal Antibody (HRP)

ECHS1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SCEH, ECHS1D

UniProt

P30084

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ECHS1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAI

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004083

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Rho Family GTPase 1 (RND1) ELISA Kit
orb1949357-01 48 Tests

Human Rho Family GTPase 1 (RND1) ELISA Kit

Sign In for Pricing
View Details
Human Rho Family GTPase 1 (RND1) ELISA Kit
orb1949357-02 96 Tests

Human Rho Family GTPase 1 (RND1) ELISA Kit

Sign In for Pricing
View Details
Polyclonal Antibody to Heat Shock 70kDa Protein 1A (HSPA1A)
TRV-0056664-01 20 µL

Polyclonal Antibody to Heat Shock 70kDa Protein 1A (HSPA1A)

Sign In for Pricing
View Details
Polyclonal Antibody to Heat Shock 70kDa Protein 1A (HSPA1A)
TRV-0056664-02 100 µL

Polyclonal Antibody to Heat Shock 70kDa Protein 1A (HSPA1A)

Sign In for Pricing
View Details
Polyclonal Antibody to Heat Shock 70kDa Protein 1A (HSPA1A)
TRV-0056664-03 200 µL

Polyclonal Antibody to Heat Shock 70kDa Protein 1A (HSPA1A)

Sign In for Pricing
View Details
Polyclonal Antibody to Heat Shock 70kDa Protein 1A (HSPA1A)
TRV-0056664-04 1 mL

Polyclonal Antibody to Heat Shock 70kDa Protein 1A (HSPA1A)

Sign In for Pricing
View Details