Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPT Rabbit Polyclonal Antibody (Biotin)

GPT Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AAT1, ALT1, GPT1

UniProt

P24298

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GPT

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQ

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_005300

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

DR5 (Death Receptor 5, CD262, HGNC:11905, KILLER, TNF-related Apoptosis-inducing Ligand Receptor 2, TRAIL Receptor 2, TRAILR2, TRAIL-R2, TRICK2, TRICK2A, TRICK2B, TRICKB, Tumor Necrosis Factor Receptor Superfamily Member 10B, TNFRSF10B, UNQ160/PRO186, ZTN
MBS6376570-01 0.1 mL

DR5 (Death Receptor 5, CD262, HGNC:11905, KILLER, TNF-related Apoptosis-inducing Ligand Receptor 2, TRAIL Receptor 2, TRAILR2, TRAIL-R2, TRICK2, TRICK2A, TRICK2B, TRICKB, Tumor Necrosis Factor Receptor Superfamily Member 10B, TNFRSF10B, UNQ160/PRO186, ZTN

Sign In for Pricing
View Details
DR5 (Death Receptor 5, CD262, HGNC:11905, KILLER, TNF-related Apoptosis-inducing Ligand Receptor 2, TRAIL Receptor 2, TRAILR2, TRAIL-R2, TRICK2, TRICK2A, TRICK2B, TRICKB, Tumor Necrosis Factor Receptor Superfamily Member 10B, TNFRSF10B, UNQ160/PRO186, ZTN
MBS6376570-02 5x 0.1 mL

DR5 (Death Receptor 5, CD262, HGNC:11905, KILLER, TNF-related Apoptosis-inducing Ligand Receptor 2, TRAIL Receptor 2, TRAILR2, TRAIL-R2, TRICK2, TRICK2A, TRICK2B, TRICKB, Tumor Necrosis Factor Receptor Superfamily Member 10B, TNFRSF10B, UNQ160/PRO186, ZTN

Sign In for Pricing
View Details
Anti-Human BACH1 Polyclonal Antibody
HT037014-01 50 µg

Anti-Human BACH1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human BACH1 Polyclonal Antibody
HT037014-02 100 µg

Anti-Human BACH1 Polyclonal Antibody

Sign In for Pricing
View Details
RpS6 antibody
70R-34575 0.1 mg

RpS6 antibody

Sign In for Pricing
View Details
Adora1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6807004 1.0 µg DNA

Adora1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details