Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACMSD Rabbit Polyclonal Antibody (FITC)

ACMSD Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q8TDX5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ACMSD

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_612199

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Histone Deacetylase 2/HDAC2 Antibody (OTI7E10) [Alexa Fluor 750]
NBP2-70881AF750 0.1 mL

Mouse Monoclonal Histone Deacetylase 2/HDAC2 Antibody (OTI7E10) [Alexa Fluor 750]

Sign In for Pricing
View Details
ATPAF2 Double Nickase Plasmid (h)
sc-413905-NIC 20 µg

ATPAF2 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
PNPLA4, CT (PNPLA4, DXS1283E, GS2, Patatin-like phospholipase domain-containing protein 4, Protein GS2) (MaxLight 550) discontinued
040225-ML550 100 µL

PNPLA4, CT (PNPLA4, DXS1283E, GS2, Patatin-like phospholipase domain-containing protein 4, Protein GS2) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Mouse Prox2 activation kit by CRISPRa
GA209492 1 Kit

Mouse Prox2 activation kit by CRISPRa

Sign In for Pricing
View Details
Pigeon Fibroblast Growth Factor 13 ELISA Kit
MBS055688 Inquire

Pigeon Fibroblast Growth Factor 13 ELISA Kit

Sign In for Pricing
View Details
CTNNA2 (NM_004389) Human 3' UTR Clone
SC211760 10 µg

CTNNA2 (NM_004389) Human 3' UTR Clone

Sign In for Pricing
View Details