Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGPP2 Rabbit Polyclonal Antibody (FITC)

SGPP2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SPP2, SPPase2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SGPP2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

XP_001128702

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPG11 Protein Vector (Mouse) (pPM-C-HA)
PV233292 500 ng

SPG11 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Canine Soluble Cluster of differentiation 163 (sCD163) ELISA Kit
MBS2604572-01 48 Well

Canine Soluble Cluster of differentiation 163 (sCD163) ELISA Kit

Sign In for Pricing
View Details
Canine Soluble Cluster of differentiation 163 (sCD163) ELISA Kit
MBS2604572-02 96 Well

Canine Soluble Cluster of differentiation 163 (sCD163) ELISA Kit

Sign In for Pricing
View Details
Canine Soluble Cluster of differentiation 163 (sCD163) ELISA Kit
MBS2604572-03 5x 96 Well

Canine Soluble Cluster of differentiation 163 (sCD163) ELISA Kit

Sign In for Pricing
View Details
Canine Soluble Cluster of differentiation 163 (sCD163) ELISA Kit
MBS2604572-04 10x 96 Well

Canine Soluble Cluster of differentiation 163 (sCD163) ELISA Kit

Sign In for Pricing
View Details
Mouse Follicle Stimulating Hormone Beta (FSHb) ELISA Kit DIY Materials
MBS2089315-01 5x 96 Tests

Mouse Follicle Stimulating Hormone Beta (FSHb) ELISA Kit DIY Materials

Sign In for Pricing
View Details