Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSM2A Rabbit Polyclonal Antibody (HRP)

ACSM2A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ACSM2, A-923A4.1

UniProt

Q08AH3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ACSM2A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WRAQTGLDIRESYGQTETGLTCMVSKTMKIKPGYMGTAASCYDVQIIDDK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001295101.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 7, NT (Caspase-7, CASP 7, CASP7, CASP-7, Apoptosis-related Cysteine Peptidase, Apoptosis Related Cysteine Protease, Apoptotic Protease MCH3, CMH 1, CMH-1, ICE-like Apoptotic Protease 3, ICE LAP3, ICE-LAP3, MCH3) (MaxLight 405) discontinued
C2087-29J-ML405 100 µL

Caspase 7, NT (Caspase-7, CASP 7, CASP7, CASP-7, Apoptosis-related Cysteine Peptidase, Apoptosis Related Cysteine Protease, Apoptotic Protease MCH3, CMH 1, CMH-1, ICE-like Apoptotic Protease 3, ICE LAP3, ICE-LAP3, MCH3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
TCF19 siRNA (Mouse)
MBS8223301-01 15 nmol

TCF19 siRNA (Mouse)

Sign In for Pricing
View Details
TCF19 siRNA (Mouse)
MBS8223301-02 30 nmol

TCF19 siRNA (Mouse)

Sign In for Pricing
View Details
TCF19 siRNA (Mouse)
MBS8223301-03 5x 30 nmol

TCF19 siRNA (Mouse)

Sign In for Pricing
View Details
CMKLR1 Polyclonal Antibody Bio Conjugated
MBS9462431-01 0.1 mL

CMKLR1 Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
CMKLR1 Polyclonal Antibody Bio Conjugated
MBS9462431-02 5x 0.1 mL

CMKLR1 Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details