Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOD1 Rabbit Polyclonal Antibody (FITC)

SOD1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ALS, SOD, ALS1, IPOA, STAHP, hSod1, HEL-S-44, homodimer

UniProt

P00441

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SOD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

IHC, WB

NCBI Accession Number

NP_000445

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal AKT3 Antibody (199822) [mFluor Violet 610 SE]
FAB14631MFV610 0.1 mL

Mouse Monoclonal AKT3 Antibody (199822) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Recombinant Burkholderia cenocepacia Chaperone protein DnaK (dnaK), partial
MBS1219535 Inquire

Recombinant Burkholderia cenocepacia Chaperone protein DnaK (dnaK), partial

Sign In for Pricing
View Details
Cryptdin 22 shRNA Plasmid (m)
sc-142593-SH 20 µg

Cryptdin 22 shRNA Plasmid (m)

Sign In for Pricing
View Details
Inhibitor hsa-miR-216a-3p AAV miRNA Vector
Amh3129600 500 ng

Inhibitor hsa-miR-216a-3p AAV miRNA Vector

Sign In for Pricing
View Details
GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (Biotin)
MBS6170715-01 0.1 mL

GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (Biotin)

Sign In for Pricing
View Details
GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (Biotin)
MBS6170715-02 5x 0.1 mL

GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (Biotin)

Sign In for Pricing
View Details