Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFV3 Rabbit Polyclonal Antibody (HRP)

NDUFV3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CI-10k, CI-9KD

UniProt

P56181

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NDUFV3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066553

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biological Microscope BMIC-207
BMIC-207 1 Unit

Biological Microscope BMIC-207

Sign In for Pricing
View Details
Human TRAIL Antibody Pair Set
E-KAB-0274 50 µL & 100 µg

Human TRAIL Antibody Pair Set

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human SIGLEC3/CD33 Protein (His Tag)
PKSH030869-01 100 µg

Recombinant Human SIGLEC3/CD33 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SIGLEC3/CD33 Protein (His Tag)
PKSH030869-02 1 mg

Recombinant Human SIGLEC3/CD33 Protein (His Tag)

Sign In for Pricing
View Details
Creatine Phosphokinase-BB (CK-BB) (CPTC-CKB-2), CF488A conjugate, 0.1mg/mL
BNC882233-500 1x 500 µL

Creatine Phosphokinase-BB (CK-BB) (CPTC-CKB-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details