Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAPPC10 Rabbit Polyclonal Antibody (HRP)

TRAPPC10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EHOC1, GT334, TMEM1, TRS30, EHOC-1, TRS130

UniProt

Q86SI7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human TRAPPC10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IVDKIRNDFCNKQSDRCVVLSDPLKDSSRTQESWNAFLTKLRTLLLMSFT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003265.3

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELF4 (ETS-related Transcription Factor Elf-4, E74-like Factor 4, Myeloid Elf-1-like Factor, MEF, ELFR) (APC)
126280-APC 100 µL

ELF4 (ETS-related Transcription Factor Elf-4, E74-like Factor 4, Myeloid Elf-1-like Factor, MEF, ELFR) (APC)

Sign In for Pricing
View Details
Rabbit Polyclonal POC5 Antibody [DyLight 350]
NBP1-78740UV 0.1 mL

Rabbit Polyclonal POC5 Antibody [DyLight 350]

Sign In for Pricing
View Details
Cortactin Rabbit pAb
APA1230-01 30 µL

Cortactin Rabbit pAb

Sign In for Pricing
View Details
Cortactin Rabbit pAb
APA1230-02 50 μL

Cortactin Rabbit pAb

Sign In for Pricing
View Details
Cortactin Rabbit pAb
APA1230-03 100 µL

Cortactin Rabbit pAb

Sign In for Pricing
View Details
Mouse Monoclonal FXR2 Antibody (1G2)
NB300-259SS 0.025 mL

Mouse Monoclonal FXR2 Antibody (1G2)

Sign In for Pricing
View Details