Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC28 Rabbit Polyclonal Antibody (FITC)

DNAJC28 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C21orf55, C21orf78

UniProt

Q9NX36

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DNAJC28

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SADEVRESFHKLAKQYHPDSGSNTADSATFIRIEKAYRKVLSHVIEQTNA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060303

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Porcine GLI Family Zinc Finger 1 (GLI1) Monoclonal Antibody
VD8N206 1 Each

Mouse Anti-Porcine GLI Family Zinc Finger 1 (GLI1) Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Adar qPCR Primer Pair
QM06626S 200 Tests

Mouse Adar qPCR Primer Pair

Sign In for Pricing
View Details
Lentiviral human PHF24 shRNA (UAS) - Lentiviral human PHF24 shRNA (UAS, RFP) (25)
GTR15344006 1 Vial

Lentiviral human PHF24 shRNA (UAS) - Lentiviral human PHF24 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
1-Butyl-4-methylpyridinium tetrafluoroborate
IL-0085-HP-0250 250 g

1-Butyl-4-methylpyridinium tetrafluoroborate

Sign In for Pricing
View Details
Human Taste Receptor Type 2 Member 43 (TAS2R43) ELISA Kit
MBS9940866-01 48 Well

Human Taste Receptor Type 2 Member 43 (TAS2R43) ELISA Kit

Sign In for Pricing
View Details
Human Taste Receptor Type 2 Member 43 (TAS2R43) ELISA Kit
MBS9940866-02 96 Well

Human Taste Receptor Type 2 Member 43 (TAS2R43) ELISA Kit

Sign In for Pricing
View Details