Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC28 Rabbit Polyclonal Antibody (HRP)

DNAJC28 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C21orf55, C21orf78

UniProt

Q9NX36

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DNAJC28

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SADEVRESFHKLAKQYHPDSGSNTADSATFIRIEKAYRKVLSHVIEQTNA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060303

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSK1 p90 (RPS6KA1) Human qPCR Template Standard (NM_002953)
HK206450 1 Kit

RSK1 p90 (RPS6KA1) Human qPCR Template Standard (NM_002953)

Sign In for Pricing
View Details
Mouse monoclonal ZNF365 Antibody (OTI9H5)
NBP2-46444 0.1 mL

Mouse monoclonal ZNF365 Antibody (OTI9H5)

Sign In for Pricing
View Details
MOT6 Polyclonal Antibody
UB-GEN-5609 100 µL

MOT6 Polyclonal Antibody

Sign In for Pricing
View Details
NY-ESO-1 (CTAG1B) Mouse Monoclonal Antibody [Clone ID: OTI4G1]
TA505950S 30 µL

NY-ESO-1 (CTAG1B) Mouse Monoclonal Antibody [Clone ID: OTI4G1]

Sign In for Pricing
View Details
PPAR delta (PPARD) (NM_001171820) Human Over-expression Lysate
LY432912 100 µg

PPAR delta (PPARD) (NM_001171820) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PEX11A Polyclonal Antibody
MBS9008319 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PEX11A Polyclonal Antibody

Sign In for Pricing
View Details