Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBR3 Rabbit Polyclonal Antibody (Biotin)

CBR3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HCBR3, SDR21C2, HEL-S-25

UniProt

O75828

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CBR3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDL

Field of Research

Metabolism Research

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001227

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal La Crosse Virus Nucleocapsid Antibody [FITC]
NBP2-41225F 0.1 mL

Rabbit Polyclonal La Crosse Virus Nucleocapsid Antibody [FITC]

Sign In for Pricing
View Details
Recombinant Human KDM4B Protein, N-His
AP97543 50 µg

Recombinant Human KDM4B Protein, N-His

Sign In for Pricing
View Details
Lentiviral mouse Zfp612 shRNA (UAS) - Lentiviral mouse Zfp612 shRNA (UAS, iRFP) (100)
GTR15251523 1 Vial

Lentiviral mouse Zfp612 shRNA (UAS) - Lentiviral mouse Zfp612 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Nfatc2 Mouse shRNA Plasmid (Locus ID 18019)
TF516359 1 Kit

Nfatc2 Mouse shRNA Plasmid (Locus ID 18019)

Sign In for Pricing
View Details
ANKRD36BP2 Protein Vector (Human) (pPM-C-HA)
PV062411 500 ng

ANKRD36BP2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
GENLISA™ Human Parathyroid Hormone Receptor 2 (PTHR2) ELISA
KBH22184 1x 96 Well

GENLISA™ Human Parathyroid Hormone Receptor 2 (PTHR2) ELISA

Sign In for Pricing
View Details