Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBR3 Rabbit Polyclonal Antibody (HRP)

CBR3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HCBR3, SDR21C2, HEL-S-25

UniProt

O75828

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CBR3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDL

Field of Research

Metabolism Research

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001227

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methcathinone Mouse mAb, Biotin conjugated
orb1291549 100 µL

Methcathinone Mouse mAb, Biotin conjugated

Sign In for Pricing
View Details
Lentiviral human RIPOR1 shRNA (UAS) - Lentiviral human RIPOR1 shRNA (UAS) (25)
GTR15162437 1 Vial

Lentiviral human RIPOR1 shRNA (UAS) - Lentiviral human RIPOR1 shRNA (UAS) (25)

Sign In for Pricing
View Details
DCN Rabbit Polyclonal Antibody
orb2955622-01 50 µg

DCN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DCN Rabbit Polyclonal Antibody
orb2955622-02 100 µg

DCN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cardiotrophin 1 (CT-1) (MaxLight 490)
MBS6467180-01 0.1 mL

Cardiotrophin 1 (CT-1) (MaxLight 490)

Sign In for Pricing
View Details
Cardiotrophin 1 (CT-1) (MaxLight 490)
MBS6467180-02 5x 0.1 mL

Cardiotrophin 1 (CT-1) (MaxLight 490)

Sign In for Pricing
View Details