Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dyrk1a Rabbit Polyclonal Antibody (Biotin)

Dyrk1a Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Dyr, Mnb, mmb, Dyrk, Mnbh, Mp86, Gm10783, D16Ertd272, D16Ertd493, D16Ertd272e, D16Ertd493e, 2310043O08Rik

UniProt

Q63470

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SFHAAGLQMAAQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQVM

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031916

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Helicobacter pylori IgM ELISA Kit
OM622946 96 Strip Well

Bovine Helicobacter pylori IgM ELISA Kit

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Nerve Growth Factor (NGF)
MBS2114066-01 0.1 mL

FITC-Linked Monoclonal Antibody to Nerve Growth Factor (NGF)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Nerve Growth Factor (NGF)
MBS2114066-02 0.2 mL

FITC-Linked Monoclonal Antibody to Nerve Growth Factor (NGF)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Nerve Growth Factor (NGF)
MBS2114066-03 0.5 mL

FITC-Linked Monoclonal Antibody to Nerve Growth Factor (NGF)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Nerve Growth Factor (NGF)
MBS2114066-04 1 mL

FITC-Linked Monoclonal Antibody to Nerve Growth Factor (NGF)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Nerve Growth Factor (NGF)
MBS2114066-05 5 mL

FITC-Linked Monoclonal Antibody to Nerve Growth Factor (NGF)

Sign In for Pricing
View Details