Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBR1 Rabbit Polyclonal Antibody (HRP)

CBR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CBR, hCBR1, PG-9-KR, SDR21C1

UniProt

P16152

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CBR1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001748

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carcinoembryonic Antigen (CEA, Carcinoembryonic Antigen-related Cell Adhesion Molecule 5, CEACAM5, CD66e, CD66e Antigen, Meconium Antigen 100) (PE)
137598-PE 100 µL

Carcinoembryonic Antigen (CEA, Carcinoembryonic Antigen-related Cell Adhesion Molecule 5, CEACAM5, CD66e, CD66e Antigen, Meconium Antigen 100) (PE)

Sign In for Pricing
View Details
Frizzled 6 Blocking Peptide
MBS824101-01 1 mg

Frizzled 6 Blocking Peptide

Sign In for Pricing
View Details
Frizzled 6 Blocking Peptide
MBS824101-02 5 mg

Frizzled 6 Blocking Peptide

Sign In for Pricing
View Details
Frizzled 6 Blocking Peptide
MBS824101-03 5x 5 mg

Frizzled 6 Blocking Peptide

Sign In for Pricing
View Details
Recombinant Janthinobacterium sp. Glutamate 5-kinase (proB)
MBS1097739-01 0.02 mg (E-Coli)

Recombinant Janthinobacterium sp. Glutamate 5-kinase (proB)

Sign In for Pricing
View Details
Recombinant Janthinobacterium sp. Glutamate 5-kinase (proB)
MBS1097739-02 0.02 mg (Yeast)

Recombinant Janthinobacterium sp. Glutamate 5-kinase (proB)

Sign In for Pricing
View Details