Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBR1 Rabbit Polyclonal Antibody (Biotin)

CBR1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CBR, hCBR1, PG-9-KR, SDR21C1

UniProt

P16152

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CBR1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001748

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NDUFB8 Antibody Picoband®, Dylight550 Conjugate
A07936-1-Dylight550 100 µg

Anti-NDUFB8 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
MMGT1, CT (MMGT1, EMC5, TMEM32, Membrane magnesium transporter 1, ER membrane protein complex subunit 5, Transmembrane protein 32) (Azide free) (HRP) discontinued
038497-HRP 200 µL

MMGT1, CT (MMGT1, EMC5, TMEM32, Membrane magnesium transporter 1, ER membrane protein complex subunit 5, Transmembrane protein 32) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
RN5S31 Recombinant Protein (Human)
RP087639 100 µg

RN5S31 Recombinant Protein (Human)

Sign In for Pricing
View Details
Akt (Phospho-Ser129) Polyclonal Conjugated Antibody
MBS9437366-01 0.1 mL (Biotin)

Akt (Phospho-Ser129) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Akt (Phospho-Ser129) Polyclonal Conjugated Antibody
MBS9437366-02 0.1 mL (AF350)

Akt (Phospho-Ser129) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Akt (Phospho-Ser129) Polyclonal Conjugated Antibody
MBS9437366-03 0.1 mL (AF405)

Akt (Phospho-Ser129) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details