Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBR1 Rabbit Polyclonal Antibody (HRP)

CBR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CBR, hCBR1, PG-9-KR, SDR21C1

UniProt

P16152

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CBR1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001748

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-LILRA2/CD85h (Rabbit, Monoclonal)
A107486 100 µL

Anti-LILRA2/CD85h (Rabbit, Monoclonal)

Sign In for Pricing
View Details
HASPIN Rabbit Polyclonal Antibody (Biotin)
orb2097214 100 µL

HASPIN Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
FAK Antibody
MBS9504319-01 0.05 mL

FAK Antibody

Sign In for Pricing
View Details
FAK Antibody
MBS9504319-02 0.1 mL

FAK Antibody

Sign In for Pricing
View Details
FAK Antibody
MBS9504319-03 5x 0.1 mL

FAK Antibody

Sign In for Pricing
View Details
ILP 2 (IAP-Like Protein 2, Inhibitor of Apoptosis Protein) (HRP) discontinued
I3500-01E-HRP 100 µL

ILP 2 (IAP-Like Protein 2, Inhibitor of Apoptosis Protein) (HRP) discontinued

Sign In for Pricing
View Details