Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP410 Rabbit Polyclonal Antibody (FITC)

CFAP410 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RDMS, SMDAX, LRRC76, YF5/A2, C21orf2

UniProt

O43822

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004919

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBC4 shRNA Plasmid (m)
sc-149845-SH 20 µg

NBC4 shRNA Plasmid (m)

Sign In for Pricing
View Details
Calcium bromide, anhydrous
IN1378-01 25 g

Calcium bromide, anhydrous

Sign In for Pricing
View Details
Calcium bromide, anhydrous
IN1378-02 250 g

Calcium bromide, anhydrous

Sign In for Pricing
View Details
AKAP4, NT (AKAP4, AKAP82, A-kinase anchor protein 4, A-kinase anchor protein 82kD, Major sperm fibrous sheath protein, Protein kinase A-anchoring protein 4) (PE) discontinued
031733-PE 200 µL

AKAP4, NT (AKAP4, AKAP82, A-kinase anchor protein 4, A-kinase anchor protein 82kD, Major sperm fibrous sheath protein, Protein kinase A-anchoring protein 4) (PE) discontinued

Sign In for Pricing
View Details
Keratocan Rabbit Polyclonal Antibody (PE)
orb2620085 100 µg

Keratocan Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
NR5A2 Recombinant Antibody, FITC Conjugated
bsm-61508R-FITC-01 20 µL

NR5A2 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details