Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT8 Rabbit Polyclonal Antibody (FITC)

CCT8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Cctq, PRED71, D21S246, C21orf112

UniProt

Q5RAP1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CCT8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006576

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP3A7 (Cytochrome P450 3A7, CYPIIIA7, Cytochrome P450-HFLA) discontinued
222022-01 50 µL

CYP3A7 (Cytochrome P450 3A7, CYPIIIA7, Cytochrome P450-HFLA) discontinued

Sign In for Pricing
View Details
CYP3A7 (Cytochrome P450 3A7, CYPIIIA7, Cytochrome P450-HFLA) discontinued
222022-02 100 µL

CYP3A7 (Cytochrome P450 3A7, CYPIIIA7, Cytochrome P450-HFLA) discontinued

Sign In for Pricing
View Details
TYRO3 (Tyrosine-protein Kinase Receptor TYRO3, Tyrosine-protein Kinase BYK, BYK, Tyrosine-protein Kinase DTK, DTK, Tyrosine-protein Kinase RSE, RSE, Tyrosine-protein Kinase SKY, SKY, Tyrosine-protein Kinase TIF, TIF) (MaxLight 550)
MBS6214615-01 0.1 mL

TYRO3 (Tyrosine-protein Kinase Receptor TYRO3, Tyrosine-protein Kinase BYK, BYK, Tyrosine-protein Kinase DTK, DTK, Tyrosine-protein Kinase RSE, RSE, Tyrosine-protein Kinase SKY, SKY, Tyrosine-protein Kinase TIF, TIF) (MaxLight 550)

Sign In for Pricing
View Details
TYRO3 (Tyrosine-protein Kinase Receptor TYRO3, Tyrosine-protein Kinase BYK, BYK, Tyrosine-protein Kinase DTK, DTK, Tyrosine-protein Kinase RSE, RSE, Tyrosine-protein Kinase SKY, SKY, Tyrosine-protein Kinase TIF, TIF) (MaxLight 550)
MBS6214615-02 5x 0.1 mL

TYRO3 (Tyrosine-protein Kinase Receptor TYRO3, Tyrosine-protein Kinase BYK, BYK, Tyrosine-protein Kinase DTK, DTK, Tyrosine-protein Kinase RSE, RSE, Tyrosine-protein Kinase SKY, SKY, Tyrosine-protein Kinase TIF, TIF) (MaxLight 550)

Sign In for Pricing
View Details
2- (3-Methoxyphenyl) -3-oxo-3- (pyridin-3-yl) propanenitrile
RBC67894-01 50 mg

2- (3-Methoxyphenyl) -3-oxo-3- (pyridin-3-yl) propanenitrile

Sign In for Pricing
View Details
2- (3-Methoxyphenyl) -3-oxo-3- (pyridin-3-yl) propanenitrile
RBC67894-02 0.5 g

2- (3-Methoxyphenyl) -3-oxo-3- (pyridin-3-yl) propanenitrile

Sign In for Pricing
View Details