Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRP1B Rabbit Polyclonal Antibody (FITC)

RRP1B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Nnp1, RRP1, NNP1L, KIAA0179, PPP1R136

UniProt

Q14684

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RRP1B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055871

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBCK1 Human Gene Knockout Kit (CRISPR)
KN203906LP 1 Kit

RBCK1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Calnexin (Endoplasmic Reticulum Marker) (CANX/1543), Biotin conjugate, 0.1mg/mL
BNCB1543-100 1x 100 µL

Calnexin (Endoplasmic Reticulum Marker) (CANX/1543), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ADAM8 (A Disintegrin And Metalloprotease 8) CLIA Kit
E-CL-H0220-01 24 Tests

Human ADAM8 (A Disintegrin And Metalloprotease 8) CLIA Kit

Sign In for Pricing
View Details
Human ADAM8 (A Disintegrin And Metalloprotease 8) CLIA Kit
E-CL-H0220-02 48 Tests

Human ADAM8 (A Disintegrin And Metalloprotease 8) CLIA Kit

Sign In for Pricing
View Details
Human ADAM8 (A Disintegrin And Metalloprotease 8) CLIA Kit
E-CL-H0220-03 96 Tests

Human ADAM8 (A Disintegrin And Metalloprotease 8) CLIA Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS804246 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details