Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRP1B Rabbit Polyclonal Antibody (HRP)

RRP1B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Nnp1, RRP1, NNP1L, KIAA0179, PPP1R136

UniProt

Q14684

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RRP1B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055871

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kadsurin A
MBS5762637 Inquire

Kadsurin A

Sign In for Pricing
View Details
OLR1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
33614154 3x 1.0 µg DNA

OLR1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
HCR (h) -PR
sc-62447-PR 10 µM - 20 µL

HCR (h) -PR

Sign In for Pricing
View Details
APC/iFluor® 700 Anti-human CD38 Antibody *HI157*
103811F2-AAT 500 Tests

APC/iFluor® 700 Anti-human CD38 Antibody *HI157*

Sign In for Pricing
View Details
TKFC Antibody - N-terminal region : FITC (ARP55279_P050-FITC)
ARP55279_P050-FITC 100 µL

TKFC Antibody - N-terminal region : FITC (ARP55279_P050-FITC)

Sign In for Pricing
View Details
LONP1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-4245R-BF680-TR 20 µL

LONP1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details