Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POFUT2 Rabbit Polyclonal Antibody (Biotin)

POFUT2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FUT13, C21orf80

UniProt

Q9Y2G5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human POFUT2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_598368

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synapsin I (SYN1) pSer9 Rabbit Polyclonal Antibody
AP02514PU-S 50 µL

Synapsin I (SYN1) pSer9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse AASDH Protein, His (Fc)-Avi-tagged
AASDH-176M 50 µg

Recombinant Mouse AASDH Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
SGSM3 CRISPRa sgRNA lentivector (set of three targets)(Rat)
43644126 3x 1.0µg DNA

SGSM3 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Rabbit Monoclonal TSC22/TSC22D1 Antibody (002) [Janelia Fluor 646]
NBP2-90141JF646 0.1 mL

Rabbit Monoclonal TSC22/TSC22D1 Antibody (002) [Janelia Fluor 646]

Sign In for Pricing
View Details
Rat Calcitonin Gene Related Peptide 1 / CGRP1 (CALCA) CLIA Kit
abx490129-01 96 Tests

Rat Calcitonin Gene Related Peptide 1 / CGRP1 (CALCA) CLIA Kit

Sign In for Pricing
View Details
Rat Calcitonin Gene Related Peptide 1 / CGRP1 (CALCA) CLIA Kit
abx490129-02 5x 96 Tests

Rat Calcitonin Gene Related Peptide 1 / CGRP1 (CALCA) CLIA Kit

Sign In for Pricing
View Details