Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DONSON Rabbit Polyclonal Antibody (FITC)

DONSON Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

B17, MIMIS, MISSLA, C21orf60

UniProt

Q9NYP3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DONSON

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060083

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMC6 (26S Protease Regulatory Subunit 10B, Proteasome 26S Subunit ATPase 6, 26S Proteasome AAA-ATPase Subunit RPT4, Proteasome Subunit p42, SUG2) (PE)
MBS6159704-01 0.1 mL

PSMC6 (26S Protease Regulatory Subunit 10B, Proteasome 26S Subunit ATPase 6, 26S Proteasome AAA-ATPase Subunit RPT4, Proteasome Subunit p42, SUG2) (PE)

Sign In for Pricing
View Details
PSMC6 (26S Protease Regulatory Subunit 10B, Proteasome 26S Subunit ATPase 6, 26S Proteasome AAA-ATPase Subunit RPT4, Proteasome Subunit p42, SUG2) (PE)
MBS6159704-02 5x 0.1 mL

PSMC6 (26S Protease Regulatory Subunit 10B, Proteasome 26S Subunit ATPase 6, 26S Proteasome AAA-ATPase Subunit RPT4, Proteasome Subunit p42, SUG2) (PE)

Sign In for Pricing
View Details
STAT4 Antibody, mAb, Rabbit
A03249-100 100 µL

STAT4 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Olfr1451 siRNA (m)
sc-150588 10 µM

Olfr1451 siRNA (m)

Sign In for Pricing
View Details
PCOLCE2, ID (PCOLCE2, PCPE2, Procollagen C-endopeptidase enhancer 2, Procollagen COOH-terminal proteinase enhancer 2) (MaxLight 650)
MBS6331833-01 0.1 mL

PCOLCE2, ID (PCOLCE2, PCPE2, Procollagen C-endopeptidase enhancer 2, Procollagen COOH-terminal proteinase enhancer 2) (MaxLight 650)

Sign In for Pricing
View Details
PCOLCE2, ID (PCOLCE2, PCPE2, Procollagen C-endopeptidase enhancer 2, Procollagen COOH-terminal proteinase enhancer 2) (MaxLight 650)
MBS6331833-02 5x 0.1 mL

PCOLCE2, ID (PCOLCE2, PCPE2, Procollagen C-endopeptidase enhancer 2, Procollagen COOH-terminal proteinase enhancer 2) (MaxLight 650)

Sign In for Pricing
View Details