Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DONSON Rabbit Polyclonal Antibody (HRP)

DONSON Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B17, MIMIS, MISSLA, C21orf60

UniProt

Q9NYP3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DONSON

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060083

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMSH (STAMBP) (NM_213622) Human Over-expression Lysate
E45H16876-2 20 µg

AMSH (STAMBP) (NM_213622) Human Over-expression Lysate

Sign In for Pricing
View Details
LRRC63 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-24099R-APC-Cy5.5 100 µL

LRRC63 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
OATA00390-25UG - Mouse CD3e Antibody : PE-Cy5
OATA00390-25UG 25 µg

OATA00390-25UG - Mouse CD3e Antibody : PE-Cy5

Sign In for Pricing
View Details
Goat Metastasis Associated Protein 1 (MTA1) ELISA Kit
GTR10342367 96 Well

Goat Metastasis Associated Protein 1 (MTA1) ELISA Kit

Sign In for Pricing
View Details
Bovine Laminin subunit gamma-1 (LAMC1) ELISA Kit
MBS2614325-01 48 Well

Bovine Laminin subunit gamma-1 (LAMC1) ELISA Kit

Sign In for Pricing
View Details
Bovine Laminin subunit gamma-1 (LAMC1) ELISA Kit
MBS2614325-02 96 Well

Bovine Laminin subunit gamma-1 (LAMC1) ELISA Kit

Sign In for Pricing
View Details