Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C21orf62 Rabbit Polyclonal Antibody (HRP)

C21orf62 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B37, PRED81, C21orf120

UniProt

Q9NYP8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C21orf62

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGDSDSREKPMWL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_062542

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gfra4 Mouse shRNA Plasmid (Locus ID 14588)
TR514933 1 Kit

Gfra4 Mouse shRNA Plasmid (Locus ID 14588)

Sign In for Pricing
View Details
Phospho-Tau (Ser396) Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-3446R-BF350-TR 20 µL

Phospho-Tau (Ser396) Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Anti-alpha 1 Fetoprotein/AFP Antibody Picoband® Fluoro550 Conjugated
A00522-3-Fluoro550 100 µg/Vial

Anti-alpha 1 Fetoprotein/AFP Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Human Leukocyte Immunoglobulin Like Receptor B1 (LILRB1) Protein
abx691459-01 50 µg

Human Leukocyte Immunoglobulin Like Receptor B1 (LILRB1) Protein

Sign In for Pricing
View Details
Human Leukocyte Immunoglobulin Like Receptor B1 (LILRB1) Protein
abx691459-02 100 µg

Human Leukocyte Immunoglobulin Like Receptor B1 (LILRB1) Protein

Sign In for Pricing
View Details
Cars Polyclonal Antibody
CAC08283-01 50 µg

Cars Polyclonal Antibody

Sign In for Pricing
View Details