Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP298 Rabbit Polyclonal Antibody (Biotin)

CFAP298 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Kur, FBB18, CILD26, C21orf48, C21orf59

UniProt

P57076

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf59

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEEL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067077

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Sorbin and SH3 domain-containing protein 1 (SORBS1) ELISA Kit
orb1656262-01 48 Tests

Rat Sorbin and SH3 domain-containing protein 1 (SORBS1) ELISA Kit

Sign In for Pricing
View Details
Rat Sorbin and SH3 domain-containing protein 1 (SORBS1) ELISA Kit
orb1656262-02 96 Tests

Rat Sorbin and SH3 domain-containing protein 1 (SORBS1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mycobacterium Vanbaalenii miaB Protein (aa 1-510)
VAng-Yyj5243-inquire Inquire

Recombinant Mycobacterium Vanbaalenii miaB Protein (aa 1-510)

Sign In for Pricing
View Details
Mouse Receptor-type tyrosine-protein phosphatase T,PTPRT ELISA KIT
JOT-EK1272Mo-01 96 Well

Mouse Receptor-type tyrosine-protein phosphatase T,PTPRT ELISA KIT

Sign In for Pricing
View Details
Mouse Receptor-type tyrosine-protein phosphatase T,PTPRT ELISA KIT
JOT-EK1272Mo-02 48 Well

Mouse Receptor-type tyrosine-protein phosphatase T,PTPRT ELISA KIT

Sign In for Pricing
View Details
Villin Mouse mAb
MBS435280-01 0.05 mL

Villin Mouse mAb

Sign In for Pricing
View Details