Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP298 Rabbit Polyclonal Antibody (HRP)

CFAP298 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Kur, FBB18, CILD26, C21orf48, C21orf59

UniProt

P57076

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf59

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEEL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067077

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium thermocellum 2-isopropylmalate synthase (leuA), partial
MBS1131805 Inquire

Recombinant Clostridium thermocellum 2-isopropylmalate synthase (leuA), partial

Sign In for Pricing
View Details
Recombinant Neisseria Gonorrhoeae rsmA Protein (aa 1-259) (strain ATCC 700825 / FA 1090)
VAng-Wyb2810-50gEcoli 50 µg (E. coli)

Recombinant Neisseria Gonorrhoeae rsmA Protein (aa 1-259) (strain ATCC 700825 / FA 1090)

Sign In for Pricing
View Details
Glutamate (BSA)
G3990-01A 100 µL

Glutamate (BSA)

Sign In for Pricing
View Details
BSA Cohn Analog ≥96% *omni, 100g
1061-100g 100 g

BSA Cohn Analog ≥96% *omni, 100g

Sign In for Pricing
View Details
Peroxisome Proliferator Activated Receptor Gamma (PPARg) Bovine ELISA Kit
F7893 96 Tests

Peroxisome Proliferator Activated Receptor Gamma (PPARg) Bovine ELISA Kit

Sign In for Pricing
View Details
Magic™ Membrane Protein Human PTTG1IP (PTTG1 interacting protein) Full Length
MPC4603K Each

Magic™ Membrane Protein Human PTTG1IP (PTTG1 interacting protein) Full Length

Sign In for Pricing
View Details