Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C21ORF58 Rabbit Polyclonal Antibody (FITC)

C21ORF58 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P58505

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C21ORF58

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MARSRLPATSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAW

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_006724081

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti Human Phosphoglycerate Mutase 2
MBS146657-01 0.005 mg

Mouse Anti Human Phosphoglycerate Mutase 2

Sign In for Pricing
View Details
Mouse Anti Human Phosphoglycerate Mutase 2
MBS146657-02 0.02 mg

Mouse Anti Human Phosphoglycerate Mutase 2

Sign In for Pricing
View Details
Mouse Anti Human Phosphoglycerate Mutase 2
MBS146657-03 0.1 mg

Mouse Anti Human Phosphoglycerate Mutase 2

Sign In for Pricing
View Details
Mouse Anti Human Phosphoglycerate Mutase 2
MBS146657-04 5x 0.1 mg

Mouse Anti Human Phosphoglycerate Mutase 2

Sign In for Pricing
View Details
Human High affinity copper uptake protein 1 ELISA Kit
MBS765652-01 48 Well

Human High affinity copper uptake protein 1 ELISA Kit

Sign In for Pricing
View Details
Human High affinity copper uptake protein 1 ELISA Kit
MBS765652-02 96 Well

Human High affinity copper uptake protein 1 ELISA Kit

Sign In for Pricing
View Details