Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM207A Rabbit Polyclonal Antibody (HRP)

FAM207A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PRED56, C21orf70

UniProt

Q9NSI2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AAVRPKGEAAPGPAPPAPEATPPPASAAGKDWAFINTNIFARTKIDPSAL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine

Tested Applications

WB

NCBI Accession Number

NP_478070

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100502600 3'UTR GFP Stable Cell Line
TU161578 1.0 mL

LOC100502600 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TrkB Rabbit mAb
F0561-100ul 100 µL

TrkB Rabbit mAb

Sign In for Pricing
View Details
Lentiviral mouse Srpr shRNA (UAS) - Lentiviral mouse Srpr shRNA (UAS, GFP) (100)
GTR15201033 1 Vial

Lentiviral mouse Srpr shRNA (UAS) - Lentiviral mouse Srpr shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
HAP1 (Huntingtin-associated Protein 1, HAP-1, Neuroan 1, HAP2, HLP1) (Biotin)
MBS6380783-01 0.1 mL

HAP1 (Huntingtin-associated Protein 1, HAP-1, Neuroan 1, HAP2, HLP1) (Biotin)

Sign In for Pricing
View Details
HAP1 (Huntingtin-associated Protein 1, HAP-1, Neuroan 1, HAP2, HLP1) (Biotin)
MBS6380783-02 5x 0.1 mL

HAP1 (Huntingtin-associated Protein 1, HAP-1, Neuroan 1, HAP2, HLP1) (Biotin)

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone
CS700507 5x 5 µm

Tissue FFPE Sections, Bone

Sign In for Pricing
View Details