Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sik1 Rabbit Polyclonal Antibody (Biotin)

Sik1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Sik, Snf1lk

UniProt

Q9R1U5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TPVLQSQAGLGATVLPPVSFQEGRRASDTSLTQGLKAFRQQLRKNARTKG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_067725

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAX1BP3 (Tax1 (human T-Cell Leukemia Virus Type I) Binding Protein 3, TIP-1) (APC)
MBS6168455-01 0.1 mL

TAX1BP3 (Tax1 (human T-Cell Leukemia Virus Type I) Binding Protein 3, TIP-1) (APC)

Sign In for Pricing
View Details
TAX1BP3 (Tax1 (human T-Cell Leukemia Virus Type I) Binding Protein 3, TIP-1) (APC)
MBS6168455-02 5x 0.1 mL

TAX1BP3 (Tax1 (human T-Cell Leukemia Virus Type I) Binding Protein 3, TIP-1) (APC)

Sign In for Pricing
View Details
Human CDSN qPCR Primer Pair
QH11749S 200 Tests

Human CDSN qPCR Primer Pair

Sign In for Pricing
View Details
CD47 Antibody
orb1326281 100 µg

CD47 Antibody

Sign In for Pricing
View Details
Recombinant NAD (P) H-quinone oxidoreductase subunit I, chloroplastic (ndhI)
MBS1435406-01 0.05 mg (E-Coli)

Recombinant NAD (P) H-quinone oxidoreductase subunit I, chloroplastic (ndhI)

Sign In for Pricing
View Details
Recombinant NAD (P) H-quinone oxidoreductase subunit I, chloroplastic (ndhI)
MBS1435406-02 0.05 mg (Yeast)

Recombinant NAD (P) H-quinone oxidoreductase subunit I, chloroplastic (ndhI)

Sign In for Pricing
View Details