Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRAP Rabbit Polyclonal Antibody (FITC)

MRAP Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

B27, FALP, FGD2, GCCD2, C21orf61

UniProt

Q8TCY5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MRAP

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR monoclonal antibody
MB66685-01 50 µL

EGFR monoclonal antibody

Sign In for Pricing
View Details
EGFR monoclonal antibody
MB66685-02 100 µL

EGFR monoclonal antibody

Sign In for Pricing
View Details
TXNDC5 Antibody
orb1319720 100 µL

TXNDC5 Antibody

Sign In for Pricing
View Details
ALG13, ID (ALG13, CXorf45, UDP-N-acetylglucosamine transferase subunit ALG13 homolog, Asparagine-linked glycosylation 13 homolog, Glycosyltransferase 28 domain-containing protein 1) (AP)
MBS6272905-01 0.2 mL

ALG13, ID (ALG13, CXorf45, UDP-N-acetylglucosamine transferase subunit ALG13 homolog, Asparagine-linked glycosylation 13 homolog, Glycosyltransferase 28 domain-containing protein 1) (AP)

Sign In for Pricing
View Details
ALG13, ID (ALG13, CXorf45, UDP-N-acetylglucosamine transferase subunit ALG13 homolog, Asparagine-linked glycosylation 13 homolog, Glycosyltransferase 28 domain-containing protein 1) (AP)
MBS6272905-02 5x 0.2 mL

ALG13, ID (ALG13, CXorf45, UDP-N-acetylglucosamine transferase subunit ALG13 homolog, Asparagine-linked glycosylation 13 homolog, Glycosyltransferase 28 domain-containing protein 1) (AP)

Sign In for Pricing
View Details
NEK4P1 Protein Vector (Human) (pPB-N-His)
PV104151 500 ng

NEK4P1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details