Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRAP Rabbit Polyclonal Antibody (HRP)

MRAP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B27, FALP, FGD2, GCCD2, C21orf61

UniProt

Q8TCY5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MRAP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNLS Protein Vector (Mouse) (pPM-C-HA)
PV224984 500 ng

RNLS Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Ogn 3'UTR GFP Stable Cell Line
TU264387 1.0 mL

Ogn 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Ribosome maturation factor RimP (rimP)
MBS1138690-01 0.02 mg (E-Coli)

Recombinant Clostridium botulinum Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Ribosome maturation factor RimP (rimP)
MBS1138690-02 0.1 mg (E-Coli)

Recombinant Clostridium botulinum Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Ribosome maturation factor RimP (rimP)
MBS1138690-03 0.02 mg (Yeast)

Recombinant Clostridium botulinum Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Ribosome maturation factor RimP (rimP)
MBS1138690-04 0.1 mg (Yeast)

Recombinant Clostridium botulinum Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details