Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPI Rabbit Polyclonal Antibody (HRP)

LIPI Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT17, LPDL, PLA1C, PRED5, mPA-PLA1 beta

UniProt

Q6XZB0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LIPI

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKIL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_945347

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPRC5B (C-term) Rabbit Polyclonal Antibody
AP51933PU-N 400 µL

GPRC5B (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Ubiquitin Conjugating Enzyme E2C (UBE2C) ELISA Kit
RD-UBE2C-Hu-01 96 Tests

Human Ubiquitin Conjugating Enzyme E2C (UBE2C) ELISA Kit

Sign In for Pricing
View Details
Human Ubiquitin Conjugating Enzyme E2C (UBE2C) ELISA Kit
RD-UBE2C-Hu-02 48 Tests

Human Ubiquitin Conjugating Enzyme E2C (UBE2C) ELISA Kit

Sign In for Pricing
View Details
4-Octylbenzenesulfonic Acid Sodium Salt
TRC-O231415-5G 5 g

4-Octylbenzenesulfonic Acid Sodium Salt

Sign In for Pricing
View Details
TEM8 (ANTXR1) (NM_018153) Human Recombinant Protein
TP304112 20 µg

TEM8 (ANTXR1) (NM_018153) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant HOMER1 Antibody
RC-5141-01 50 μL

Recombinant HOMER1 Antibody

Sign In for Pricing
View Details