Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRTAP24-1 Rabbit Polyclonal Antibody (FITC)

KRTAP24-1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KAP24.1

UniProt

Q3LI83

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KRTAP24-1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LVRNYHYSSYRPTSCRPLSYLSRSFRSLSYIPSTFPPLRYLCSGSRPLKC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001078924

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMC1 (SMC1A) Mouse Monoclonal Antibody [Clone ID: OTI5A1]
CF809793 100 µg

SMC1 (SMC1A) Mouse Monoclonal Antibody [Clone ID: OTI5A1]

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), 1mg/mL
BNUM2559-50 1x 50 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), 1mg/mL

Sign In for Pricing
View Details
PLET1 Human Gene Knockout Kit (CRISPR)
KN427346 1 Kit

PLET1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/3126R), CF647 conjugate, 0.1mg/mL
BNC473126-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/3126R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Protein A/G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS
MG08F-PAG 10x 96 Well Plates

Protein A/G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Clear PS

Sign In for Pricing
View Details
BCL10 (122-168) Mouse Monoclonal Antibody [Clone ID: BL10/411]
AM32814PU-T 20 µg

BCL10 (122-168) Mouse Monoclonal Antibody [Clone ID: BL10/411]

Sign In for Pricing
View Details