Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEMO1 Rabbit Polyclonal Antibody (FITC)

MEMO1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

0610016J10Rik, D930048L02Rik

UniProt

Q91VH6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MEMO1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_598532.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CDK2 Protein (Baculovirus, His Tag)
PKSH031501-01 50 µg

Recombinant Human CDK2 Protein (Baculovirus, His Tag)

Sign In for Pricing
View Details
Recombinant Human CDK2 Protein (Baculovirus, His Tag)
PKSH031501-02 500 µg

Recombinant Human CDK2 Protein (Baculovirus, His Tag)

Sign In for Pricing
View Details
Recombinant Human HPCAL1 Protein (His Tag)
PKSH032547-01 10 µg

Recombinant Human HPCAL1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human HPCAL1 Protein (His Tag)
PKSH032547-02 50 µg

Recombinant Human HPCAL1 Protein (His Tag)

Sign In for Pricing
View Details
Cytokeratin 5/8 (C-50), CF594 conjugate, 0.1mg/mL
BNC940948-100 1x 100 µL

Cytokeratin 5/8 (C-50), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF594 conjugate, 0.1mg/mL
BNC942598-500 1x 500 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details