Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEMO1 Rabbit Polyclonal Antibody (HRP)

MEMO1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

0610016J10Rik, D930048L02Rik

UniProt

Q91VH6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MEMO1.

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_598532.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBLIM1 AAV Vector (Mouse) (CMV)
20275105 1 µg

FBLIM1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
EIF2gamma Antibody
orb806031 2 mg

EIF2gamma Antibody

Sign In for Pricing
View Details
Phospho-NRP1 (Thr916) Rabbit Polyclonal Antibody (PerCP)
orb1590719 100 µL

Phospho-NRP1 (Thr916) Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Bremelanotide Acetate
P1108-5mg 5 mg

Bremelanotide Acetate

Sign In for Pricing
View Details
Anti-GSTM1 Antibody Picoband® (monoclonal, 11F2) (Dylight488 Conjugate)
M00569-Dylight488 100 µg

Anti-GSTM1 Antibody Picoband® (monoclonal, 11F2) (Dylight488 Conjugate)

Sign In for Pricing
View Details
N- (3-piperidin-1-ylpropyl) piperidine-4-carboxamide dihydrochloride
sc-354610A 1 g

N- (3-piperidin-1-ylpropyl) piperidine-4-carboxamide dihydrochloride

Sign In for Pricing
View Details