GUCY1B1 Rabbit Polyclonal Antibody (Biotin)
GUCY1B1 Rabbit Polyclonal Antibody (Biotin)
Product Specifications
Product Name Alternative
GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B3, GC-S-beta-1
UniProt
Q02153
Immunogen
The immunogen is a synthetic peptide directed towards the following sequence VTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENS
Clonality
Polyclonal
Conjugation
Biotin
Sequence
Synthetic peptide located within the following region: VTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENS
Purification
Affinity Purified
Form
Liquid. Purified antibody supplied in 1x PBS buffer.
Molecular Weight
71 kDa
Storage Conditions
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Notes
For research use only.
Prediction Reactivity
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
NCBI Accession Number
NP_000848
Host or Source
Rabbit
Preservative
Liquid. Purified antibody supplied in 1x PBS buffer.
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1488559-01 0.05 mg
Rabbit anti-human Src kinase-associated phosphoprotein 1 polyclonal Antibody, HRP conjugated
Sign In for Pricing
View Details MBS1488559-02 0.1 mg
Rabbit anti-human Src kinase-associated phosphoprotein 1 polyclonal Antibody, HRP conjugated
Sign In for Pricing
View Details MBS1488559-03 5x 0.1 mg
Rabbit anti-human Src kinase-associated phosphoprotein 1 polyclonal Antibody, HRP conjugated
Sign In for Pricing
View Details SIPH169Hu01-01 10 µg
Recombinant Late Cornified Envelope Like Proline Rich Protein 1 (LELP1)
Sign In for Pricing
View Details SIPH169Hu01-02 50 µg
Recombinant Late Cornified Envelope Like Proline Rich Protein 1 (LELP1)
Sign In for Pricing
View Details SIPH169Hu01-03 200 µg
Recombinant Late Cornified Envelope Like Proline Rich Protein 1 (LELP1)
Sign In for Pricing
View Details